PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005732
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 663aa    MW: 74486 Da    PI: 4.4806
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-43627PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.6e-12518561146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++W++++ el+++av+q+G++  + I ++++ gRt+ q+ks++ k
        Lsa005732 518 RMKWSKQDTELFYEAVQQFGTD-LSMIKECFP-GRTRQQIKSKYKK 561
                      79********************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159634.7E-24513593No hitNo description
PROSITE profilePS512939.152516567IPR017884SANT domain
SMARTSM007174.7E-9517565IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-7518561IPR009057Homeodomain-like
CDDcd001671.73E-7520561No hitNo description
SuperFamilySSF466893.29E-10520567IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MDIDFDDLTS TDAANNVNAS TKLKPKPKPK PKPKPKTQPE PKSTPTPPTQ PVEDAATADN  60
EIIARTEEEQ QPFDVNQVSG NINDNWQSSF EKPHEENAEP FPTLESLNDL LPQSTTVTVN  120
SPPVSETPTA IHVSMDENIE KGPIEGLSNT VDACTNLESL AQIDPLTGEE ASIFNDNEDF  180
QIESLSSVSK GAENALFWEP LDILSESRIC AGPKVCKFKP KPNAQTRKVE SIHSVSSQID  240
YMDNAPVPTF TPEELFGSPS IGITDSIPPE SLSDFHLNEE QEPTTFTEMS QMDSVVPSEH  300
PDAIPEALNK GKGQSLENEA SRSSERLRKQ SKKTLALVDE FEDEGVADDV IHGNEDDNNI  360
DDYRPEESES VSERKGKKSK KAVKEKEKPV RKRKKANSEA PAESTKVKKK FPHSTRRRNK  420
RQVDPQLLII PEEDLNKNEI PMKELIRLAE HRERIAKKEA ASTSGTGTPA LNQSGGSFSN  480
NFDYEDEGFG EGRDDDYLME AENATYYNYR THMKITPRMK WSKQDTELFY EAVQQFGTDL  540
SMIKECFPGR TRQQIKSKYK KEEKQQPLRL NHALTTRFKG NSHFEVVIQR LKEAQGEDSE  600
NDDPMNLTGE DDVAADINEA EETTKSVEPE KKDEEMEGDV GSPTKSHDSE DEMYRWSQYK  660
SEI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1383394KEKEKPVRKRKK
2387393KPVRKRK
3390394RKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103XM380.0A0A103XM38_CYNCS; Homeodomain-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.17e-35MYB_related family protein